A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10391
Swiss-prot Accession number	O45027 (Sequence in FASTA format)
Description	PBAN-type neuropeptides precursor [Contains: Diapause hormone homolog(DH); Alpha-SG neuropeptide (MAB-alpha-NP); Beta-SG neuropeptide (MAB-beta-NP); Pheromone biosynthesis-activating neuropeptide (MaB-PBAN);Gamma-SG neuropeptide (MAB-gamma-NP)] (Fragment).
Source organism	Mamestra brassicae (Cabbage armyworm)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea;Noctuidae; Hadeninae; Mamestra.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the pyrokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	155 Amino acids
Molecular weight	18096
References	1  PubMed abstract 9684333
Domain Name	N/A
Hormone Name	Diapause hormone homolog
Mature Hormone Sequence	GLWFGPRI
Position of mature hormone in Pre-Hormone protein	fragment Residues from position
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10392
Swiss-prot Accession number	O45027 (Sequence in FASTA format)
Description	PBAN-type neuropeptides precursor [Contains: Diapause hormone homolog(DH); Alpha-SG neuropeptide (MAB-alpha-NP); Beta-SG neuropeptide (MAB-beta-NP); Pheromone biosynthesis-activating neuropeptide (MaB-PBAN);Gamma-SG neuropeptide (MAB-gamma-NP)] (Fragment).
Source organism	Mamestra brassicae (Cabbage armyworm)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea;Noctuidae; Hadeninae; Mamestra.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the pyrokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	155 Amino acids
Molecular weight	18096
References	1  PubMed abstract 9684333
Domain Name	N/A
Hormone Name	Alpha-SG neuropeptide
Mature Hormone Sequence	VIFTPKL
Position of mature hormone in Pre-Hormone protein	7 Residues from position (58-64)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10393
Swiss-prot Accession number	O45027 (Sequence in FASTA format)
Description	PBAN-type neuropeptides precursor [Contains: Diapause hormone homolog(DH); Alpha-SG neuropeptide (MAB-alpha-NP); Beta-SG neuropeptide (MAB-beta-NP); Pheromone biosynthesis-activating neuropeptide (MaB-PBAN);Gamma-SG neuropeptide (MAB-gamma-NP)] (Fragment).
Source organism	Mamestra brassicae (Cabbage armyworm)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea;Noctuidae; Hadeninae; Mamestra.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the pyrokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	155 Amino acids
Molecular weight	18096
References	1  PubMed abstract 9684333
Domain Name	N/A
Hormone Name	Beta-SG neuropeptide
Mature Hormone Sequence	SLAYDDKVFENVEFTPRL
Position of mature hormone in Pre-Hormone protein	18 Residues from position (67-84)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10394
Swiss-prot Accession number	O45027 (Sequence in FASTA format)
Description	PBAN-type neuropeptides precursor [Contains: Diapause hormone homolog(DH); Alpha-SG neuropeptide (MAB-alpha-NP); Beta-SG neuropeptide (MAB-beta-NP); Pheromone biosynthesis-activating neuropeptide (MaB-PBAN);Gamma-SG neuropeptide (MAB-gamma-NP)] (Fragment).
Source organism	Mamestra brassicae (Cabbage armyworm)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea;Noctuidae; Hadeninae; Mamestra.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the pyrokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	PBAN is an hormone that controls sex pheromone production in female moths and pheromone responsiveness in male. PBAN also mediates visceral muscle contractile activity (myotropic activity)
Protein Length	155 Amino acids
Molecular weight	18096
References	1  PubMed abstract 9684333
Domain Name	N/A
Hormone Name	Pheromone biosynthesis-activating neuropeptide
Mature Hormone Sequence	LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL
Position of mature hormone in Pre-Hormone protein	33 Residues from position (88-120)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10395
Swiss-prot Accession number	O45027 (Sequence in FASTA format)
Description	PBAN-type neuropeptides precursor [Contains: Diapause hormone homolog(DH); Alpha-SG neuropeptide (MAB-alpha-NP); Beta-SG neuropeptide (MAB-beta-NP); Pheromone biosynthesis-activating neuropeptide (MaB-PBAN);Gamma-SG neuropeptide (MAB-gamma-NP)] (Fragment).
Source organism	Mamestra brassicae (Cabbage armyworm)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea;Noctuidae; Hadeninae; Mamestra.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the pyrokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	155 Amino acids
Molecular weight	18096
References	1  PubMed abstract 9684333
Domain Name	N/A
Hormone Name	Gamma-SG neuropeptide
Mature Hormone Sequence	TMNFSPRL
Position of mature hormone in Pre-Hormone protein	8 Residues from position (123-130)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated